PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00007.227
Common NameAMTR_s00007p00227160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 194aa    MW: 20864.8 Da    PI: 8.9755
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00007.227genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601361.3e-42181171100
                                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAeara 69 
                                               +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+
  evm_27.model.AmTr_v1.0_scaffold00007.227  18 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKMLMEVPEQQRADAANSLVYEANVRL 86 
                                               7******************************************************************** PP

                                    DUF260  70 rdPvyGavgvilklqqqleqlkaelallkee 100
                                               rdPvyG++g i++lqqq+++l+ael+++++e
  evm_27.model.AmTr_v1.0_scaffold00007.227  87 RDPVYGCMGAISALQQQVQSLQAELNAVRAE 117
                                               ***************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.88817118IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-4218115IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MGRRSPLLAP GALNTITPCA ACKLLRRRCA QECPFSPYFS PHEPHKFASV HKVFGASNVS  60
KMLMEVPEQQ RADAANSLVY EANVRLRDPV YGCMGAISAL QQQVQSLQAE LNAVRAEILR  120
YKYRESQGIL QSVSHSTLLA NAGHTPPPPP LPPPPTQVSR PPISVAVSTS AVYMPASSSD  180
FSSISNDNAS YFG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006843741.21e-140PREDICTED: LOB domain-containing protein 15
SwissprotQ9AT612e-71LBD13_ARATH; LOB domain-containing protein 13
TrEMBLW1PCQ71e-140W1PCQ7_AMBTC; Uncharacterized protein
STRINGVIT_13s0067g02380.t015e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.19e-70LOB domain-containing protein 15
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]